PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F02372.1.p
Common NameEUGRSUZ_F02372, LOC104449346
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 235aa    MW: 25886.6 Da    PI: 8.9493
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F02372.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.43e-174186147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      +g+W++eEd  l  +v+++G+++W++I+r++  gR++k+c++rw + 
  Eucgr.F02372.1.p 41 KGPWSAEEDRVLTGLVERYGPRNWSLISRHIE-GRSGKSCRLRWCNQ 86
                      79******************************.***********985 PP

2Myb_DNA-binding50.45.2e-1695137347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       ++++ Ed+ ++ a++ +G++ W+tIar ++ gRt++ +k++w++ 
  Eucgr.F02372.1.p  95 PFSAAEDDAILAAHAVYGNR-WATIARLLP-GRTDNAVKNHWNST 137
                       79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.2193687IPR017930Myb domain
SuperFamilySSF466899.71E-3138134IPR009057Homeodomain-like
SMARTSM007173.2E-144089IPR001005SANT/Myb domain
PfamPF002495.7E-164186IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-244294IPR009057Homeodomain-like
CDDcd001673.33E-134385No hitNo description
PROSITE profilePS5129424.98788142IPR017930Myb domain
SMARTSM007174.7E-1592140IPR001005SANT/Myb domain
CDDcd001676.61E-1195138No hitNo description
Gene3DG3DSA:1.10.10.605.1E-2295141IPR009057Homeodomain-like
PfamPF002496.3E-1395137IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MDTTYRRSSP ACSSSSSDSS SSDSSSRRNP ASSARKTDRV KGPWSAEEDR VLTGLVERYG  60
PRNWSLISRH IEGRSGKSCR LRWCNQLSPA VKHRPFSAAE DDAILAAHAV YGNRWATIAR  120
LLPGRTDNAV KNHWNSTLKR RASAQQKDDG ANHGNDHRND HMSVSGCRVD IEDEDGPFTA  180
LTLAPPGAAA AAAEGRREDK GLPEEGFWEV MRGVIAREVR DYMNSTMMAE TSWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-42381424108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F02372.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010061776.11e-172PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW15e-55MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A059BRN81e-172A0A059BRN8_EUCGR; Uncharacterized protein
STRINGGLYMA06G04010.18e-87(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM145531122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.12e-49myb domain protein 77